Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis Dolichol-phosphate mannosyltransferase (DPM1)

This Recombinant Ustilago maydis Dolichol-phosphate mannosyltransferase (DPM1) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Dolichol-phosphate mannosyltransferase, EC= 2.4.1.83, Dolichol-phosphate mannose synthase, DPM synthase, Dolichyl-phosphate beta-D-mannosyltransferase, Mannose-P-dolichol synthase

UniProt

P54856

Expression Region

1-294

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIALDMDASAKMRKQPGSSGWSTSSTPSCSVIVPAFRENLNLRPLVTRLSSAFASQSSS ELANTEIIIVDDNSRDGSVETVSALQSEGYNVRIIVRTSERGLSSAVVRGFREARGQRMI CMDADLQHPPEAVPSLLLALNGQKSFVLGTRYGVGVSMDKDWPLHRRIISSGARMLARPL TSASDPMSGFFGITKHSFHTADHHINAQGFKIALDLLVKSGVHSTDIAEVPFSFGLRQEG ESKLDGKVMFKYLQQLVELYRFRFGTVPIVFVLIVLLVLALYIWSHVLAPMLGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF740 conjugate, 0.1mg/mL
BNC740892-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LINGO4 (C-term) Rabbit Polyclonal Antibody
AP52491PU-N 400 µL

LINGO4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A1]
TA809117BM 100 µL

Alkaline Phosphatase (ALPL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A1]

Sign In for Pricing
View Details
STX8 Antibody
KC-15315-01 50 μL

STX8 Antibody

Sign In for Pricing
View Details
STX8 Antibody
KC-15315-02 100 µL

STX8 Antibody

Sign In for Pricing
View Details
STX8 Antibody
KC-15315-03 1 mL

STX8 Antibody

Sign In for Pricing
View Details