Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Hemolysin E (hlyE)

This Recombinant Salmonella paratyphi A Hemolysin E (hlyE) spans the amino acid sequence from region 2-303.

Product Specifications

Product Name Alternative

Hemolysin E, Cytotoxin ClyA, Silent hemolysin SheA

UniProt

Q93RR6

Expression Region

2-303

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TGIFAEQTVEVVKSAIETADGALDFYNKYLDQVIPWKTFDETIKELSRFKQEYSQEASVL VGDIKVLLMDSQDKYFEATQTVYEWCGVVTQLLSAYILLFDEYNEKKASAQKDILIRILD DGVNKLNEAQKSLLGSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDRIRKEAYAGA AAGIVAGPFGLIISYSIAAGVIEGKLIPELNDRLKAVQNFFTSLSVTVKQANKDIDAAKL KLATEIAAIGEIKTETETTRFYVDYDDLMLSLLKGAAKKMINTCNEYQQRHGKKTLLEVP DI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D, L-Mevalonic Acid Lactone-d3
017632 1 mg

D, L-Mevalonic Acid Lactone-d3

Sign In for Pricing
View Details
NFKBIL1, ID (NFKBIL1, IKBL, NF-kappa-B inhibitor-like protein 1, Inhibitor of kappa B-like protein, Nuclear factor of kappa light polypeptide gene enhancer in B Cells inhibitor-like 1) (MaxLight 650) discontinued
038945-ML650 100 µL

NFKBIL1, ID (NFKBIL1, IKBL, NF-kappa-B inhibitor-like protein 1, Inhibitor of kappa B-like protein, Nuclear factor of kappa light polypeptide gene enhancer in B Cells inhibitor-like 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Psma2 (NM_017279) Rat Tagged ORF Clone
RR206279 10 µg

Psma2 (NM_017279) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. holarctica DNA-directed RNA polymerase subunit beta (rpoB), partial
MBS1106232 Inquire

Recombinant Francisella tularensis subsp. holarctica DNA-directed RNA polymerase subunit beta (rpoB), partial

Sign In for Pricing
View Details
MAGED1 Recombinant Protein (Human)
RP018640 100 µg

MAGED1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Rat Elp6 Pre-designed siRNA Set A
SI204398A 1 Each

Rat Elp6 Pre-designed siRNA Set A

Sign In for Pricing
View Details