Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Hemolysin E (hlyE)

This Recombinant Salmonella paratyphi A Hemolysin E (hlyE) spans the amino acid sequence from region 2-303.

Product Specifications

Product Name Alternative

Hemolysin E, Cytotoxin ClyA, Silent hemolysin SheA

UniProt

Q93RR6

Expression Region

2-303

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

TGIFAEQTVEVVKSAIETADGALDFYNKYLDQVIPWKTFDETIKELSRFKQEYSQEASVL VGDIKVLLMDSQDKYFEATQTVYEWCGVVTQLLSAYILLFDEYNEKKASAQKDILIRILD DGVNKLNEAQKSLLGSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDRIRKEAYAGA AAGIVAGPFGLIISYSIAAGVIEGKLIPELNDRLKAVQNFFTSLSVTVKQANKDIDAAKL KLATEIAAIGEIKTETETTRFYVDYDDLMLSLLKGAAKKMINTCNEYQQRHGKKTLLEVP DI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)
TMPH-00178-01 5 µg

AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)

Sign In for Pricing
View Details
AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)
TMPH-00178-02 10 µg

AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)

Sign In for Pricing
View Details
AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)
TMPH-00178-03 20 µg

AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)

Sign In for Pricing
View Details
AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)
TMPH-00178-04 50 µg

AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)

Sign In for Pricing
View Details
AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)
TMPH-00178-05 100 µg

AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)

Sign In for Pricing
View Details
AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)
TMPH-00178-06 200 µg

AiiA Protein, Bacillus thuringiensis subsp., Recombinant (His & Myc)

Sign In for Pricing
View Details