Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fusobacterium nucleatum subsp. nucleatum Protease HtpX homolog (htpX)

This Recombinant Fusobacterium nucleatum subsp. nucleatum Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

Q8R664

Expression Region

1-309

Origin

Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGLAELKNKIVKAPHLNIFKIGTWVTMGLFATFLLVYIFVGDEMLNYYPLLILFAFGTP FISLMISKATVKRAYNIRMIGDGGASTEKEKLVVDTVTLLSQKLDLQKFPEIGVYPSNDI NAFATGASKNSAMVAVSQGLLNSMNETEIIGVLAHEMSHVVNGDMLTSSILEGFVSAFGV IATLPFLMGENNNRGRRAASSMATYYMVRNVANIFGKIVSSAYSRRREYGADKLAAEITD PSYMKSALLRLQEISEGRISLQNSDREFASFKITNNFSMGNIFGNLFASHPSLAKRIAAI ERMEKTTKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-500 1x 500 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP3 (Rabbit PAb), CF488A conjugate, 0.1mg/mL
BNC880408-100 1x 100 µL

TIMP3 (Rabbit PAb), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details