Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ybdG (ybdG)

This Recombinant Bacillus subtilis Uncharacterized protein ybdG (ybdG) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Uncharacterized protein ybdG

UniProt

O31431

Expression Region

1-325

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLWKVLKIVFVSLAALVLLVSVSVFIYHHFQLNKEAALLKGKGTVVDVDGKKMNVYQE GSGKDTFVFMSGSGIAAPAYEMKGLYSKFSKENKIAVVDRAGYGYSEVSHDDRDIDTVLE QTRKALMKSGNKPPYILMPHSISGIEAMYWAQKYPKEIKAIIAMDIGLPQQYVTYKLSGV DRLKVRGFHLLTSIGFHRFIPSAVYNPEVIRQSFLTDEEKEIYKAINFKQFFNADMEHEL LQSYQNGSKSVNLPAPKETPVLILDAVSDQNRHSKYAIQNRKDYEAFAAQFNTADIKELR GTHSIYLYQPDQIYKLSMEFMRKVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARNT2 Antibody
orb1256016 100 µL

ARNT2 Antibody

Sign In for Pricing
View Details
Monkey Wiskott-Aldrich Syndrome Protein (WASP) ELISA Kit
MBS9945563-01 48 Well

Monkey Wiskott-Aldrich Syndrome Protein (WASP) ELISA Kit

Sign In for Pricing
View Details
Monkey Wiskott-Aldrich Syndrome Protein (WASP) ELISA Kit
MBS9945563-02 96 Well

Monkey Wiskott-Aldrich Syndrome Protein (WASP) ELISA Kit

Sign In for Pricing
View Details
Monkey Wiskott-Aldrich Syndrome Protein (WASP) ELISA Kit
MBS9945563-03 5x 96 Well

Monkey Wiskott-Aldrich Syndrome Protein (WASP) ELISA Kit

Sign In for Pricing
View Details
Monkey Wiskott-Aldrich Syndrome Protein (WASP) ELISA Kit
MBS9945563-04 10x 96 Well

Monkey Wiskott-Aldrich Syndrome Protein (WASP) ELISA Kit

Sign In for Pricing
View Details
Alanine Aminopeptidase (AAP) Recombinant, Rat
153409-01 10 µg

Alanine Aminopeptidase (AAP) Recombinant, Rat

Sign In for Pricing
View Details