Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ybdG (ybdG)

This Recombinant Bacillus subtilis Uncharacterized protein ybdG (ybdG) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Uncharacterized protein ybdG

UniProt

O31431

Expression Region

1-325

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTLWKVLKIVFVSLAALVLLVSVSVFIYHHFQLNKEAALLKGKGTVVDVDGKKMNVYQE GSGKDTFVFMSGSGIAAPAYEMKGLYSKFSKENKIAVVDRAGYGYSEVSHDDRDIDTVLE QTRKALMKSGNKPPYILMPHSISGIEAMYWAQKYPKEIKAIIAMDIGLPQQYVTYKLSGV DRLKVRGFHLLTSIGFHRFIPSAVYNPEVIRQSFLTDEEKEIYKAINFKQFFNADMEHEL LQSYQNGSKSVNLPAPKETPVLILDAVSDQNRHSKYAIQNRKDYEAFAAQFNTADIKELR GTHSIYLYQPDQIYKLSMEFMRKVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Annexin A1
DB 266-0.5 500 µL

Anti-Annexin A1

Sign In for Pricing
View Details
TRNAF17P Protein Vector (Human) (pPB-C-His)
PV138778 500 ng

TRNAF17P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CDK4 Rabbit Polyclonal Antibody (BF405)
orb1585071 100 µL

CDK4 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Immunization Grade Human Type I Collagen, 1 mg, lyophilized
1065 1 mg

Immunization Grade Human Type I Collagen, 1 mg, lyophilized

Sign In for Pricing
View Details
Recombinant Syntrophomonas wolfei subsp. wolfei DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1431090-01 0.02 mg (E-Coli)

Recombinant Syntrophomonas wolfei subsp. wolfei DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Syntrophomonas wolfei subsp. wolfei DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1431090-02 0.1 mg (E-Coli)

Recombinant Syntrophomonas wolfei subsp. wolfei DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details