Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv0885/MT0908 (Rv0885, MT0908)

This Recombinant Uncharacterized protein Rv0885/MT0908 (Rv0885, MT0908) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv0885/MT0908

UniProt

P0A5D5

Expression Region

1-340

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRTRIVRRWRRNMDVADDAEYVEMLATLSEGSVRRNFNPYTDIDWESPEFAVTDNDPRW ILPATDPLGRHPWYQAQSRERQIEIGMWRQANVAKVGLHFESILIRGLMNYTFWMPNGSP EYRYCLHESVEECNHTMMFQEMVNRVGADVPGLPRRLRWVSPLVPLVAGPLPVAFFIGVL AGEEPIDHTQKNVLREGKSLHPIMERVMSIHVAEEARHISFAHEYLRKRLPRLTRMQRFW ISLYFPLTMRSLCNAIVVPPKAFWEEFDIPREVKKELFFGSPESRKWLCDMFADARMLAH DTGLMNPIARLVWRLCKIDGKPSRYRSEPQRQHLAAAPAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant IL-2 Receptor alpha Antibody
RC-15149-01 50 μL

Recombinant IL-2 Receptor alpha Antibody

Sign In for Pricing
View Details
Recombinant IL-2 Receptor alpha Antibody
RC-15149-02 100 µL

Recombinant IL-2 Receptor alpha Antibody

Sign In for Pricing
View Details
Recombinant IL-2 Receptor alpha Antibody
RC-15149-03 1 mL

Recombinant IL-2 Receptor alpha Antibody

Sign In for Pricing
View Details
ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF594 conjugate, 0.1mg/mL
BNC942426-500 1x 500 µL

ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant NKX6-1 Antibody
RC-3083-01 50 μL

Recombinant NKX6-1 Antibody

Sign In for Pricing
View Details
Recombinant NKX6-1 Antibody
RC-3083-02 100 µL

Recombinant NKX6-1 Antibody

Sign In for Pricing
View Details