Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Monopolar spindle protein 2 (MPS2)

This Recombinant Candida glabrata Monopolar spindle protein 2 (MPS2) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Monopolar spindle protein 2

UniProt

Q6FS52

Expression Region

1-356

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEVDVPELLFERVWLQVDRDRDGFIYAKQMPSFITQCEQVIKDTVNTNKTDFHMTRFKN RLKLPLLPKLHMDLIDAFAKETPYYKIYKESFSDMLNKLTGNNFSTVINKIFEDCDGFPA SFISALEVKADVKSSPRSKADSLGSPIKVDLLRNLKPQEEPETPRRINRKYKSLELQLES MKRELEDKEKTIMNNERNLTELRSTISKLKEKYDLLSEEYEQRHIHGGNNGTAIKHDVVI GELKSRLQEQNRLIRILQEQIQFDPQLKRETRVHDNKSKNNTFNGAIAYVIPFLLFIFVI RSLITKEDIGDATMALPWWERNNLASRLAWYFRDVFSNDSAKFLESDAYDKVFGIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBP, AlpHcAbs® Rabbit antibody
HA710087 100 µg

MBP, AlpHcAbs® Rabbit antibody

Sign In for Pricing
View Details
N-(p-Coumaroyl) Serotonin
TRC-C756300-2.5MG 2.5 mg

N-(p-Coumaroyl) Serotonin

Sign In for Pricing
View Details
Alpha-1-Antitrypsin (SERPINA1) (Hepatocellular & Histiocytic Marker) (AAT/3167R), CF568 conjugate, 0.1mg/mL
BNC683167-500 1x 500 µL

Alpha-1-Antitrypsin (SERPINA1) (Hepatocellular & Histiocytic Marker) (AAT/3167R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
REEP1 (NM_001164732) Human Over-expression Lysate
LC431110 20 µg

REEP1 (NM_001164732) Human Over-expression Lysate

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF488A conjugate, 0.1mg/mL
BNC882540-500 1x 500 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Icos (NM_017480) Mouse Tagged ORF Clone
MG202040 10 µg

Icos (NM_017480) Mouse Tagged ORF Clone

Sign In for Pricing
View Details