Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Translocation protein SEC62 (SEC62)

This Recombinant Human Translocation protein SEC62 (SEC62) spans the amino acid sequence from region 1-399.

Product Specifications

Product Name Alternative

Translocation protein SEC62, Translocation protein 1, TP-1, hTP-1

UniProt

Q99442

Expression Region

1-399

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKE EDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLD GNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE TKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNG NDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Tek Tyrosine Kinase, Endothelial ELISA Kit
MBS102711 Inquire

Cat Tek Tyrosine Kinase, Endothelial ELISA Kit

Sign In for Pricing
View Details
PSMC3 Antibody; Biotin conjugated
MBS7003155-01 0.05 mg

PSMC3 Antibody; Biotin conjugated

Sign In for Pricing
View Details
PSMC3 Antibody; Biotin conjugated
MBS7003155-02 0.1 mg

PSMC3 Antibody; Biotin conjugated

Sign In for Pricing
View Details
PSMC3 Antibody; Biotin conjugated
MBS7003155-03 5x 0.1 mg

PSMC3 Antibody; Biotin conjugated

Sign In for Pricing
View Details
FAK, phosphorylated (Tyr397, Tyr407, Tyr576, Tyr577, Tyr861) (Focal Adhesion Associated Protein Tyrosine Kinase, BC3) (MaxLight 405) discontinued
F0019-55J-ML405 100 µL

FAK, phosphorylated (Tyr397, Tyr407, Tyr576, Tyr577, Tyr861) (Focal Adhesion Associated Protein Tyrosine Kinase, BC3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
APXL CRISPR Activation Plasmid (m2)
sc-431018-ACT-2 20 µg

APXL CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details