Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Simian foamy virus type 1 Envelope glycoprotein gp130 (env)

This Recombinant Simian foamy virus type 1 Envelope glycoprotein gp130 (env) spans the amino acid sequence from region 573-989.

Product Specifications

Product Name Alternative

Envelope glycoprotein gp130, Env polyprotein, Cleaved into the following 3 chains:, 1. Leader peptide, 2. LP, Env leader protein, Elp, gp18LP

UniProt

P23073

Expression Region

573-989

Origin

Simian foamy virus type 1 (SFVmac) (SFV-1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RSVNNYERLRSMGYALTGAVQTLSQISDINDERLQHGVYLLRDHVVTLMEAALHDVSIME GMLAIQHVHTHLNHLKTMLLMRKIDWTFIRSDWIQQQLQKTDDEMKLIRRTARSLVYYVT QTSSSPTATSWEIGIYYEIVIPKHIYLNNWQVINVGHLLESAGHLTHVKVKHPYEIINKE CSDTQYLHLEECIREDYVICDIVQIVQPCGNATELSDCPVTALKVKTPYIQVSPLKNGSY LVLSSTKDCSIPAYVPSVVTVNETVKCFGVEFHKPLYAETKTSYEPQVPHLKLRLPHLTG IIASLQSLEIEVTSTQENIKDQIERAKAQLLRLDIHEGDFPDWLKQVASATRDVWPAAAS FIQGVGNFLSNTAQGIFGSAVSLLFYAKPILIGIGVILLIALLFKIISWLPGKPKKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-100 1x 100 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-100 1x 100 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-100 1x 100 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details