Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis serovar E Deubiquitinase and deneddylase Dub1 (cdu1)

This Recombinant Chlamydia trachomatis serovar E Deubiquitinase and deneddylase Dub1 (cdu1) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Deubiquitinase and deneddylase Dub1, ChlaDub1, EC= 3.4.22.-

UniProt

D3UTF4

Expression Region

1-418

Origin

Chlamydia trachomatis serovar E (strain Sweden2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSPTNSTSKTAPVPPQDSSKPVLISEEPQNQLLQKVARTALVVLLVVVTLGLILLFYSF SDLQSFPWCCQTRPSTKEQPTISIPVPLPSPPLAVPRPSTPPPPVISRPSMPPAPTPAIS PPSTPSAPKPSTPPPLPPKAPKPVKTQEDLLPFVPEQVFVEMYEDMARRRTIEALVPAWD SDIIFKCLCYFHTLYQGLIPLETFPPATIFNFKQKIISILEDKKAVLRGEPIKGSLPICC SEENYRRHLHGTTLLPVFMWYHPTPKTLSDTMQTMKQLAIKGSVGASHWLLVIVDIQARR LVYFDSLYNYVMSPEDMEKDLQSFAQQLDQVYPAYDSQKFSVKIAAKEVIQKGSGSSCGA WCCQFLHWYLRDPFTDALNDLPVDSVERHENLASFVQACEAAVQDLPELFWPEAKALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
BNC880460-500 1x 500 µL

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-100 1x 100 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-500 1x 500 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-100 1x 100 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Milk Fat Globulin (MFG-06), CF647 conjugate, 0.1mg/mL
BNC470227-500 1x 500 µL

Milk Fat Globulin (MFG-06), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details