Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis Deubiquitinase and deneddylase Dub1 (cdu1)

This Recombinant Chlamydia trachomatis Deubiquitinase and deneddylase Dub1 (cdu1) spans the amino acid sequence from region 1-418.

Product Specifications

Product Name Alternative

Deubiquitinase and deneddylase Dub1, ChlaDub1, EC= 3.4.22.-

UniProt

O84876

Expression Region

1-418

Origin

Chlamydia trachomatis (strain D/UW-3/Cx)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSPTNSTSKKAPVPPQDSSKPVLISEEPQNQLLQKVARTALAVLLVVVTLGLILLFYSF SDLQSFPWCCQTRPSTKEQPTISIPVPLPSPPLAVPRPSTPPPPVISRPSTPPAPTPAIS PPSTPSAPKPSTPPPLPPKAPKPVKTQEDLLPFVPEQVFVEMYEDMARRWIIEALVPAWD SDIIFKCLCYFHTLYQGLIPLETFPPATIFNFKQKIISILEDKKAVLRGEPIKGSLPICC SEENYRRHLHGTTLLPVFMWYHPTPKTLSDTMQTMKQLAIKGSVGASHWLLVIVDIQARR LVYFDSLYNYVMSPEDMEKDLQSFAQQLDQVYPAYDSQKFSVKIAAKEVIQKGSGSSCGA WCCQFLHWYLRDPFTDALNDLPVDSVERHENLASFVQACEAAVQDLPELFWPEAKALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-500 1x 500 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
BNC880177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF647 conjugate, 0.1mg/mL
BNC471527-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF568 conjugate, 0.1mg/mL
BNC682284-500 1x 500 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/144B), CF488A conjugate, 0.1mg/mL
BNC880749-500 1x 500 µL

CD8 (C8/144B), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details