Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein HflK (hflK)

This Recombinant Protein HflK (hflK) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Protein HflK

UniProt

P0ABC8

Expression Region

1-419

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGKG TGSGGGSSSQGPRPQLGGRVVTIAAAAIVIIWAASGFYTIKEAERGVVTRFGKFSHLVEP GLNWKPTFIDEVKPVNVEAVRELAASGVMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSP DDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQA ARPPEEVKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEARAYKAQTILE AQGEVARFAKLLPEYKAAPEITRERLYIETMEKVLGNTRKVLVNDKGGNLMVLPLDQMLK GGNAPAAKSDNGASNLLRLPPASSSTTSGASNTSSTSQGDIMDQRRANAQRNDYQRQGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC30A7 siRNA (Rat)
MBS8217309-01 15 nmol

SLC30A7 siRNA (Rat)

Sign In for Pricing
View Details
SLC30A7 siRNA (Rat)
MBS8217309-02 30 nmol

SLC30A7 siRNA (Rat)

Sign In for Pricing
View Details
SLC30A7 siRNA (Rat)
MBS8217309-03 5x 30 nmol

SLC30A7 siRNA (Rat)

Sign In for Pricing
View Details
Influenza A H10N3 (A/mallard/Minnesota/Sg-00194/2007) Hemagglutinin Protein (HA1 Subunit) (His Tag)
PO54620M2 100 µg

Influenza A H10N3 (A/mallard/Minnesota/Sg-00194/2007) Hemagglutinin Protein (HA1 Subunit) (His Tag)

Sign In for Pricing
View Details
Em Series Replacement Element 250ml
HEA5204 1 Each

Em Series Replacement Element 250ml

Sign In for Pricing
View Details
Recombinant Human LIM and senescent cell antigen-like-containing domain protein 1 (LIMS1)
CSB-EP232922HU-01 20 µg

Recombinant Human LIM and senescent cell antigen-like-containing domain protein 1 (LIMS1)

Sign In for Pricing
View Details