Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Magnesium transporter MRS2-A, chloroplastic (MRS2-A)

This Recombinant Oryza sativa subsp. japonica Magnesium transporter MRS2-A, chloroplastic (MRS2-A) spans the amino acid sequence from region 56-474.

Product Specifications

Product Name Alternative

Magnesium transporter MRS2-A, chloroplastic

UniProt

Q9AUK4

Expression Region

56-474

Origin

Oryza sativa subsp. japonica (Rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAGRGGAGGLLLLPPLPALRAAEGKDGRAVTKDEEEEAAAAAVEEEGEVEVRREEDKPGD DGSREAAARGSGSGRFSADYISLGIREPVYEVIEVKSNGRMSTKKISRRQLLKSSGLRLR DTRSVDPSLWLMNSMPSLLVREQAILVNLGSLRAIAMHERVLIFNYNSPGGKAFLDSLLP RLNPRNINGGPAMPFQLEVVEAALLSRIQRLERRLMRIEPRVGALLEVLPNRLTADVLEQ LRLSKQALVELGSRAGDLKQMLIDLLDDPHEIRRICIMGRNCTLDKLSDNMECSVPLEKQ IAEEEEEEIEMLLENYLQRCESIHGQAERLLDSAREMEDSIAVNLSSRRLEVSRVELLLQ VGTFCVAIGALIAGIFGMNLKSYLETNAWAFWATTGGIVVGAVAGFFIMYSYLKTRKIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-500 1x 500 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-500 1x 500 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF640R conjugate, 0.1mg/mL
BNC401893-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details