Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig G protein-activated inward rectifier potassium channel 4 (KCNJ5)

This Recombinant Pig G protein-activated inward rectifier potassium channel 4 (KCNJ5) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

G protein-activated inward rectifier potassium channel 4, GIRK-4, Cardiac inward rectifier, CIR, Heart KATP channel, Inward rectifier K (+) channel Kir3.4, KATP-1

UniProt

O02670

Expression Region

1-419

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGDSRNAMNQDMEIGVTPRDPKKIPKQARDYIPIATDRTRLLAEGKKPRQRYMEKSGKC NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIVLLLVQAILGSIVNA FMVGCMFVKISQPKKRAETLMFSNHAVISLRDEKLCLMFRVGDLRNSHIVEASIRAKLIK SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLNQEEFE VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP SCCAKELAEMKREGRLLQYLPSPPLPGGCAGAELEAEAEQEGEDEPEGLRGSRETRDSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL
BNC940994-100 1x 100 µL

TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-500 1x 500 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-100 1x 100 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details