Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sphingomyelin phosphodiesterase 2 (Smpd2)

This Recombinant Mouse Sphingomyelin phosphodiesterase 2 (Smpd2) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Sphingomyelin phosphodiesterase 2, EC= 3.1.4.12, Lyso-platelet-activating factor-phospholipase C, Lyso-PAF-PLC, Neutral sphingomyelinase, N-SMase

UniProt

O70572

Expression Region

1-419

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLNFSLRLRVFNLNCWDIPYLSKHRADRMKRLGDFLNLENFDLALLEEVWSEQDFQYLR QRLSLTYPDAHYFRSGMIGSGLCVFSKHPIQEIFQHVYSLNGYPYMFHHGDWFCGKSVGL LVLRLSGLVLNAYVTHLHAEYSRQKDIYFAHRVAQAWELAQFIHHTSKNADVVLLCGDLN MHPKDLGCCLLKEWTGLHDAFVETEDFKGSDDGCTMVPKNCYVSQQDLGPFPSGIRIDYV LYKAVSEFHVCCETLKTTTGCDPHSDKPFSDHEALMATLYVKHSPPQEDPCTACGPLERS DLISVLREARTELGLGIAKARWWAAFSGYVIVWGLSLLVLLCVLAAGEEAREVAIILCIP SVGLVLVAGAVYLFHKQEAKGLCRAQAEMLHVLTRETETQDRGSEPHLAYCLQQEGDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK11, NT (I29) (Serine/Threonine-protein Kinase 11, Serine/Threonine-protein Kinase LKB1, Renal Carcinoma Antigen NY-REN-19, LKB1, PJS) (PE) discontinued
S7973-58Y5-PE 200 µL

STK11, NT (I29) (Serine/Threonine-protein Kinase 11, Serine/Threonine-protein Kinase LKB1, Renal Carcinoma Antigen NY-REN-19, LKB1, PJS) (PE) discontinued

Sign In for Pricing
View Details
2,4-dichloro-1- ((4-methoxybenzyl) oxy) benzene
OR1090882-01 250 mg

2,4-dichloro-1- ((4-methoxybenzyl) oxy) benzene

Sign In for Pricing
View Details
2,4-dichloro-1- ((4-methoxybenzyl) oxy) benzene
OR1090882-02 500 mg

2,4-dichloro-1- ((4-methoxybenzyl) oxy) benzene

Sign In for Pricing
View Details
2,4-dichloro-1- ((4-methoxybenzyl) oxy) benzene
OR1090882-03 1 g

2,4-dichloro-1- ((4-methoxybenzyl) oxy) benzene

Sign In for Pricing
View Details
2,4-dichloro-1- ((4-methoxybenzyl) oxy) benzene
OR1090882-04 5 g

2,4-dichloro-1- ((4-methoxybenzyl) oxy) benzene

Sign In for Pricing
View Details
2,4-dichloro-1- ((4-methoxybenzyl) oxy) benzene
OR1090882-05 10 g

2,4-dichloro-1- ((4-methoxybenzyl) oxy) benzene

Sign In for Pricing
View Details