Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sphingomyelin phosphodiesterase 2 (Smpd2)

This Recombinant Mouse Sphingomyelin phosphodiesterase 2 (Smpd2) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Sphingomyelin phosphodiesterase 2, EC= 3.1.4.12, Lyso-platelet-activating factor-phospholipase C, Lyso-PAF-PLC, Neutral sphingomyelinase, N-SMase

UniProt

O70572

Expression Region

1-419

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLNFSLRLRVFNLNCWDIPYLSKHRADRMKRLGDFLNLENFDLALLEEVWSEQDFQYLR QRLSLTYPDAHYFRSGMIGSGLCVFSKHPIQEIFQHVYSLNGYPYMFHHGDWFCGKSVGL LVLRLSGLVLNAYVTHLHAEYSRQKDIYFAHRVAQAWELAQFIHHTSKNADVVLLCGDLN MHPKDLGCCLLKEWTGLHDAFVETEDFKGSDDGCTMVPKNCYVSQQDLGPFPSGIRIDYV LYKAVSEFHVCCETLKTTTGCDPHSDKPFSDHEALMATLYVKHSPPQEDPCTACGPLERS DLISVLREARTELGLGIAKARWWAAFSGYVIVWGLSLLVLLCVLAAGEEAREVAIILCIP SVGLVLVAGAVYLFHKQEAKGLCRAQAEMLHVLTRETETQDRGSEPHLAYCLQQEGDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog TRAIL (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit
EK245467 96 Well

Dog TRAIL (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit

Sign In for Pricing
View Details
SYTL4, NT (SYTL4, Synaptotagmin-like protein 4, Exophilin-2, Granuphilin) (PE)
MBS6353115-01 0.2 mL

SYTL4, NT (SYTL4, Synaptotagmin-like protein 4, Exophilin-2, Granuphilin) (PE)

Sign In for Pricing
View Details
SYTL4, NT (SYTL4, Synaptotagmin-like protein 4, Exophilin-2, Granuphilin) (PE)
MBS6353115-02 5x 0.2 mL

SYTL4, NT (SYTL4, Synaptotagmin-like protein 4, Exophilin-2, Granuphilin) (PE)

Sign In for Pricing
View Details
RFLNA Antibody
orb1279510 100 µL

RFLNA Antibody

Sign In for Pricing
View Details
Recombinant Brucella Abortus trpD Protein (strain S19) (aa 1-339)
VAng-Lsx4813-50gEcoli 50 µg (E. coli)

Recombinant Brucella Abortus trpD Protein (strain S19) (aa 1-339)

Sign In for Pricing
View Details
DNAJB4 (DnaJ (Hsp40) Homolog, Subfamily B, Member 4, DNAJW, DjB4, HLJ1) (MaxLight 750)
MBS6237952-01 0.1 mL

DNAJB4 (DnaJ (Hsp40) Homolog, Subfamily B, Member 4, DNAJW, DjB4, HLJ1) (MaxLight 750)

Sign In for Pricing
View Details