Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sphingomyelin phosphodiesterase 2 (Smpd2)

This Recombinant Mouse Sphingomyelin phosphodiesterase 2 (Smpd2) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

Sphingomyelin phosphodiesterase 2, EC= 3.1.4.12, Lyso-platelet-activating factor-phospholipase C, Lyso-PAF-PLC, Neutral sphingomyelinase, N-SMase

UniProt

O70572

Expression Region

1-419

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLNFSLRLRVFNLNCWDIPYLSKHRADRMKRLGDFLNLENFDLALLEEVWSEQDFQYLR QRLSLTYPDAHYFRSGMIGSGLCVFSKHPIQEIFQHVYSLNGYPYMFHHGDWFCGKSVGL LVLRLSGLVLNAYVTHLHAEYSRQKDIYFAHRVAQAWELAQFIHHTSKNADVVLLCGDLN MHPKDLGCCLLKEWTGLHDAFVETEDFKGSDDGCTMVPKNCYVSQQDLGPFPSGIRIDYV LYKAVSEFHVCCETLKTTTGCDPHSDKPFSDHEALMATLYVKHSPPQEDPCTACGPLERS DLISVLREARTELGLGIAKARWWAAFSGYVIVWGLSLLVLLCVLAAGEEAREVAIILCIP SVGLVLVAGAVYLFHKQEAKGLCRAQAEMLHVLTRETETQDRGSEPHLAYCLQQEGDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR1 Mouse Monoclonal Antibody [Clone ID: OTI1A3]
TA802990 100 µL

FGFR1 Mouse Monoclonal Antibody [Clone ID: OTI1A3]

Sign In for Pricing
View Details
RPL7P38 AAV Vector (Human) (CMV)
41898101 1 µg

RPL7P38 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
ST8SIA4 Antibody - middle region : Biotin (ARP48679_P050-Biotin)
ARP48679_P050-Biotin 100 µL

ST8SIA4 Antibody - middle region : Biotin (ARP48679_P050-Biotin)

Sign In for Pricing
View Details
Canine Inositol 1,4,5-Trisphosphate Receptor Type 1 (ITPR1) ELISA Kit
MBS9930979-01 48 Well

Canine Inositol 1,4,5-Trisphosphate Receptor Type 1 (ITPR1) ELISA Kit

Sign In for Pricing
View Details
Canine Inositol 1,4,5-Trisphosphate Receptor Type 1 (ITPR1) ELISA Kit
MBS9930979-02 96 Well

Canine Inositol 1,4,5-Trisphosphate Receptor Type 1 (ITPR1) ELISA Kit

Sign In for Pricing
View Details
Canine Inositol 1,4,5-Trisphosphate Receptor Type 1 (ITPR1) ELISA Kit
MBS9930979-03 5x 96 Well

Canine Inositol 1,4,5-Trisphosphate Receptor Type 1 (ITPR1) ELISA Kit

Sign In for Pricing
View Details