Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BDLF2 (BDLF2)

This Recombinant Epstein-Barr virus Protein BDLF2 (BDLF2) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Protein BDLF2

UniProt

P03225

Expression Region

1-420

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDEQVAVEHGTVSHTISREEDGVVHERRVLASGERVEVFYKAPAPRPREGRASTFHDFT VPAAAAVPGPEPEPEPHPPMPIHANGGGETKTNTQDQNQNQTTRTRTNAKAEERTAEMDD TMASSGGQRGAPISADLLSLSSLTGRMAAMAPSWMKSEVCGERMRFKEDVYDGEAETLAE PPRCFMLSFVFIYYCCYLAFLALLAFGFNPLFLPSFMPVGAKVLRGKGRDFGVPLSYGCP TNPFCKVYTLIPAVVINNVTYYPNNTDSHGGHGGFEAAALHVAALFESGCPNLQAVTNRN RTFNVTRASGRVERRLVQDMQRVLASAVVVMHHHCHYETYYVFDGVGPEFGTIPTPCFKD VLAFRPSLVTNCTAPLKTSVKGPNWSGAAGGMKRKQCRVDRLTDRSFPAYLEEVMYVMVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Thyroid gland
CS511350 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
GNAO1 antibody - middle region (ARP55425_P050)
ARP55425_P050 100 µL

GNAO1 antibody - middle region (ARP55425_P050)

Sign In for Pricing
View Details
ATPB Recombinant Rabbit mAb, PE conjugated
orb2350616 100 µL

ATPB Recombinant Rabbit mAb, PE conjugated

Sign In for Pricing
View Details
Anti-ASIC4 Antibody
CTA2917-01 30 µL

Anti-ASIC4 Antibody

Sign In for Pricing
View Details
Anti-ASIC4 Antibody
CTA2917-02 50 μL

Anti-ASIC4 Antibody

Sign In for Pricing
View Details
Anti-ASIC4 Antibody
CTA2917-03 100 µL

Anti-ASIC4 Antibody

Sign In for Pricing
View Details