Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine herpesvirus 1.2 Glycoprotein GX

This Recombinant Bovine herpesvirus 1.2 Glycoprotein GX spans the amino acid sequence from region 25-444.

Product Specifications

Product Name Alternative

Glycoprotein GX

UniProt

Q08103

Expression Region

25-444

Origin

Bovine herpesvirus 1.2 (strain ST) (BoHV-1) (Infectious bovine rhinotracheitis virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RPAPDDLCFADVRRTGMAPSRPLGPVLNLAASDLTSRVSVRAVDASRGCALALLDMAETV VPGGPRAADVVDVGWAYQDGDCMVPLAYRQYFNCTGGALPGQNVCAGLSETRIRGGFGTS DYALYGTSLVLRPGLYDRGTYIYFLGYGPDDIYVGSVTLMVGADIHKYPCGLDRGLGVAL HHKSGPARPLTEDDATGDWACGCFPAVVEVDVVWGNVSAAELGLADPIDYADEGGEVEVL EDEAGSASGNLPQDDPDPDLADCRTVGLFSESDMFRTARGPESLLIGAVAKDVLTVPLNL PPGRSYEALRNASLECNSRPRETGDAAVVVMSLQEPARLERRPDARATDPEFGLFGLPDD PAVRRGILIGLAIALLVLLFSLVIVLVCACRLARAAKAARRARAATFAKSNPAYEPMLRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-500 1x 500 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-100 1x 100 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgM Immunoglobulin (IM260), CF568 conjugate, 0.1mg/mL
BNC680260-500 1x 500 µL

IgM Immunoglobulin (IM260), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF640R conjugate, 0.1mg/mL
BNC401497-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details