Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Torsin-4A-A (tor4a-a)

This Recombinant Xenopus laevis Torsin-4A-A (tor4a-a) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Torsin-4A-A, Torsin family 4 member A-A

UniProt

Q0IHC5

Expression Region

1-420

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEETESSTQTPVPQHGISLASYPVRAVIRMRRKIRTLKKSRLQLDLTGGRSLDSAKASLR RQISMDRATLFKSSTYEKQQYFNFDTPTLEKLALNSQIRKRNRKKSRHVLYPGNVRKCLP VEHKSKAKRCLLLFIGIVCFQILNAIENLDDNLQKYDLDGLEKTLQREVFGQKRAIEKLM DHLQDYLATHYHNKPLVLSFNGPSGVGKSHTGRLLAKHFRSIMDNDFVLQYYTMHNCPNE NDVTQCQSEMSGLISEMISRAEIEEKIPVFIFDEVEVMPVALLDVLHRYFQLNQSNEYLN AVYILISNIGGNEITKFVLQNASNDFLNLPQELHQIVISSLQKHHSLWDVAEIVPFTLLE KKHILDCFLDELLREGFYPDHSNIESLAGQLRYYTKENKEYSISGCKQVVAKVNLLQPYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-500 1x 500 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-500 1x 500 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
BNC040745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details