Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis LETM1 domain-containing protein LETM2, mitochondrial (letm2)

This Recombinant Xenopus tropicalis LETM1 domain-containing protein LETM2, mitochondrial (letm2) spans the amino acid sequence from region 25-444.

Product Specifications

Product Name Alternative

LETM1 domain-containing protein LETM2, mitochondrial, LETM1 and EF-hand domain-containing protein 2, Leucine zipper-EF-hand-containing transmembrane protein 1-like

UniProt

Q28DA8

Expression Region

25-444

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NLCPIYTSVSCAQNRAYAPRSSCLVQAAFVSPSWSSRAFHTSGFCLQDAPPSPPPPSTPP SPPEPEKAPQVVRKSLGQRVVDEIKHFYHGFRLLGIDTKVAARMVWRLLHGQVLTRRERR RLMRTCADLFRLVPFMVFVIVPFMEFLLPVFLKLFPEMLPSTFETESKKEEKVKKKLAAK LEMAKFLQETISEMARRNKAETGADTQQQFSSYVQQVRGTGEQPSTKEIVRFSKLFEDEL TLEHLERSQLVALCRLLELPPIGTNNLLRFQLMMQLRSIRADDEMISKEGVENLTVAELQ AASRARGMRSLGLTEEQLKEQMKQWLDLHLKENVPPSLLLLSRALYLTELKPKPILPLKQ AVEIPKINPAVVEAVEAKDNLADTAPTLKGLKGEELVSGTLLKESAVQSKENTKASANGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-500 1x 500 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-100 1x 100 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
BNC740034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details