Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Mitochondrial chaperone BCS1 (bcs1l)

This Recombinant Danio rerio Mitochondrial chaperone BCS1 (bcs1l) spans the amino acid sequence from region 1-420.

Product Specifications

Product Name Alternative

Mitochondrial chaperone BCS1, BCS1-like protein

UniProt

Q7ZV60

Expression Region

1-420

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLSDFIGALKDNPYFGAGFGLVGVGTALAVARKGAQVGMIFFRRHYMITLEVPSKDKSY HWLLSWITKHAKHTQHLSVETSYMQHESGKVHTQFDFHPSPGNHIIWYGRKWIRVERVRE KQMMDLHTGTPWESVTFTALGRDRQTFFNILQEARELALKQEEGRTVMYTAMGAEWRPFG FPRRRRPLSSVVLESGVAERIVDDVKEFIGNPKWYTDRGIPYRRGYLLYGPPGCGKSSFI TALAGELGYSICLMSLSDRSLSDDRLNHLLSVAPQQSIILLEDVDAAFVSRELLPTENPL AYQGMGRLTFSGLLNALDGVASSEARIVFMTTNFIERLDPALVRPGRVDLKQYVGHCSHW QLTQMFRRFYPQESAAEADHFSEQALAAHTDLSAAQVQGHFMLYKTDPAGAIKNIAEIKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-FNTB Rabbit mAb
CMA5418-01 30 µL

Recombinant Anti-FNTB Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-FNTB Rabbit mAb
CMA5418-02 50 μL

Recombinant Anti-FNTB Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-FNTB Rabbit mAb
CMA5418-03 100 µL

Recombinant Anti-FNTB Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-FNTB Rabbit mAb
CMA5418-04 200 µL

Recombinant Anti-FNTB Rabbit mAb

Sign In for Pricing
View Details
Sheep TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit
MBS2507266-01 24 Tests

Sheep TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit

Sign In for Pricing
View Details
Sheep TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit
MBS2507266-02 48 Tests

Sheep TNFRSF1B (Tumor Necrosis Factor Receptor Superfamily, Member 1B) ELISA Kit

Sign In for Pricing
View Details