Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas phage Pf1 Uncharacterized protein ORF424

This Recombinant Pseudomonas phage Pf1 Uncharacterized protein ORF424 spans the amino acid sequence from region 1-424.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF424, ORF 424

UniProt

P25131

Expression Region

1-424

Origin

Pseudomonas phage Pf1 (Bacteriophage Pf1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIKIHHGPNGSYKTSGAIQDDAVPALKDGRVIITNVRGFTLERAYQVFPDLPNTAEIIN LDLESLEDLEKMRTWFQWAPRGAFLIFDETQLLFPKSWREKDLERFDYPGGPEAAHAADR PMGWLDAWTRHRHFNWDIVLTTPNISYIRDDIRMTCEMAYKHSNLAVIGIPGRYKEAQHD AQLNRPPADGTIIEYKRIRKQTFALYQSTATGKTQDTKAGKSLFRSPKLVLLLALLAGTI GFVWYMGPLRTIGGPAAATPADAPGDPAQAPAAPAAVAAPARPAANSFLPPGLVPDGPAA APVDLNAHPFADRRISILAHAYRKSRGDIYMFALEDPTGRHLELTSWQLIGSGYRVTPKG ECVVELRYEDWKQTVTCAGRQAGAVASIAPAAPVAASADAPARGQSPLTIVPDSEYASRP WRQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRPPA (NM_001101426) Human Recombinant Protein
TP325744 20 µg

CRPPA (NM_001101426) Human Recombinant Protein

Sign In for Pricing
View Details
CCDC90A (MCUR1) (NM_001031713) Human Over-expression Lysate
LC422164 20 µg

CCDC90A (MCUR1) (NM_001031713) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclin B1 (V92.1), CF405S conjugate, 0.1mg/mL
BNC040680-500 1x 500 µL

Cyclin B1 (V92.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat c-KIT/CD117 Protein (His Tag)
PKSR030234 50 µg

Recombinant Rat c-KIT/CD117 Protein (His Tag)

Sign In for Pricing
View Details
LMCD1 Rabbit Polyclonal Antibody
TA370585 100 µL

LMCD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS712451 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details