Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Abhydrolase domain-containing protein 2 (ABHD2)

This Recombinant Macaca fascicularis Abhydrolase domain-containing protein 2 (ABHD2) spans the amino acid sequence from region 1-425.

Product Specifications

Product Name Alternative

Abhydrolase domain-containing protein 2, EC= 3.1.1.-

UniProt

Q4R2Y9

Expression Region

1-425

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCP LLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEH CVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYG CTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSAL RAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLS EKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKSQCSDTEQV EADLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-100 1x 100 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF640R conjugate, 0.1mg/mL
BNC402083-100 1x 100 µL

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details