Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana CBS domain-containing protein CBSX6 (CBSX6)

This Recombinant Arabidopsis thaliana CBS domain-containing protein CBSX6 (CBSX6) spans the amino acid sequence from region 1-425.

Product Specifications

Product Name Alternative

CBS domain-containing protein CBSX6

UniProt

Q8GZA4

Expression Region

1-425

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASVFLYHVVGDLTVGKPEMVEFYETETVESAIRAIGESTECGIPVWRKRTTPSLPGFVE NSEMRQQRFVGILNSLDIVAFLAKTECLQEEKAMKIPVSEVVSPDNTLLKQVDPGTRLID ALEMMKQGVRRLLVPKSVVWRGMSKRFSILYNGKWLKNSENSSSSSGLSADSTNRPTTSM TSSRDKFCCLSREDVIRFLIGVLGALAPLPLTSISTLGIINQNYNFIEASLPAIEATRRP LCDPSAIAVLEQTENEQQFKIIGEISASKLWKCDYLAAAWALANLYAGQFVMGVEDNMSS RSFSDFLQTSFPGGEQNGTATNAKKFSSRSIGFNPTSPTRLSIGRSMYRGRSAPLTCKTS SSLAAVMAQMLSHRATHVWVTEADSDDVLVGVVGYGEILTAVTKQPSAFVPSNRSYEGFG NENQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
BNC740994-100 1x 100 µL

TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-100 1x 100 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF594 conjugate, 0.1mg/mL
BNC942452-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details