Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Abhydrolase domain-containing protein 2 (Abhd2)

This Recombinant Mouse Abhydrolase domain-containing protein 2 (Abhd2) spans the amino acid sequence from region 1-425.

Product Specifications

Product Name Alternative

Abhydrolase domain-containing protein 2, EC= 3.1.1.-, Lung alpha/beta hydrolase 2, MmLABH2

UniProt

Q9QXM0

Expression Region

1-425

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCP LLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEH CVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYG CTWEFGAMVNYIKRTYPQTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSAL RAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLS EKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKSQCSDTEQM EAELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma genitalium Probable glycerol uptake facilitator protein (glpF)
MBS7015816-01 0.02 mg

Recombinant Mycoplasma genitalium Probable glycerol uptake facilitator protein (glpF)

Sign In for Pricing
View Details
Recombinant Mycoplasma genitalium Probable glycerol uptake facilitator protein (glpF)
MBS7015816-02 0.1 mg

Recombinant Mycoplasma genitalium Probable glycerol uptake facilitator protein (glpF)

Sign In for Pricing
View Details
Recombinant Mycoplasma genitalium Probable glycerol uptake facilitator protein (glpF)
MBS7015816-03 5x 0.1 mg

Recombinant Mycoplasma genitalium Probable glycerol uptake facilitator protein (glpF)

Sign In for Pricing
View Details
Anti-HDLM2 PS1 Aptamer
CTApt-304 10 nmol

Anti-HDLM2 PS1 Aptamer

Sign In for Pricing
View Details
Human Recombinant Human Nicotinic Acetylcholine Receptor epsilon Protein
NBC1-22617 0.1 mg

Human Recombinant Human Nicotinic Acetylcholine Receptor epsilon Protein

Sign In for Pricing
View Details
Avidin (Biotin)
A4500-01A-Biotin 100 µL

Avidin (Biotin)

Sign In for Pricing
View Details