Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Phosphate regulon sensor protein phoR (phoR)

This Recombinant Haemophilus influenzae Phosphate regulon sensor protein phoR (phoR) spans the amino acid sequence from region 1-425.

Product Specifications

Product Name Alternative

Phosphate regulon sensor protein phoR, EC= 2.7.13.3

UniProt

P71380

Expression Region

1-425

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKILNFIVEINLAIIISLFTSDFILWFAIILLLILAWHHINEYRLLKYLNLKQDNKFSL LQLGTFSQTEAYHRHQIYKEKCASLRLLSQINKNIKYLPDAIIICQHNGNISWCNSIAPQ MFDFCWDKKVQENIFDVIFYEQFKHYFFSPKKRRPLVLLTYNQRYIEVQSHAYNSHMILV IARDITDMIHLLNSRQKFLSNINHELRTPLTVLQGYLEILADNNIQNPLQKKAIXAMQEQ SQRMEHLLQQFNFLAKIETTSDKDFRKFDMSAMINSLRKDTDILNTYNHHIEFIIQPNII IFGNESQLRSAVSNLIYNAIKHSGKQCHIQIQWETCEQGIKFNVIDNGVGISPQHIPHLT ERFYRVDESRSHLTGGSGLGLAIVKHTLLQYHSHLNIESTETKGSSFSFIIPKRFVISKN NKEIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Protein dpy-19 homolog 4, DPY19L4 ELISA Kit
MBS9333664-01 48 Well

Mouse Protein dpy-19 homolog 4, DPY19L4 ELISA Kit

Sign In for Pricing
View Details
Mouse Protein dpy-19 homolog 4, DPY19L4 ELISA Kit
MBS9333664-02 96 Well

Mouse Protein dpy-19 homolog 4, DPY19L4 ELISA Kit

Sign In for Pricing
View Details
Mouse Protein dpy-19 homolog 4, DPY19L4 ELISA Kit
MBS9333664-03 5x 96 Well

Mouse Protein dpy-19 homolog 4, DPY19L4 ELISA Kit

Sign In for Pricing
View Details
Mouse Protein dpy-19 homolog 4, DPY19L4 ELISA Kit
MBS9333664-04 10x 96 Well

Mouse Protein dpy-19 homolog 4, DPY19L4 ELISA Kit

Sign In for Pricing
View Details
Blvrb (NM_144923) Mouse Tagged ORF Clone
MG202180 10 µg

Blvrb (NM_144923) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Fetoprotein, Alpha (Alpha Fetoprotein, Alpha, Alpha-fetoprotein Precursor, AFP, Alpha-1-fetoprotein, Alpha-fetoglobulin, FETA, HPAFP) discontinued
137953 1 mg

Fetoprotein, Alpha (Alpha Fetoprotein, Alpha, Alpha-fetoprotein Precursor, AFP, Alpha-1-fetoprotein, Alpha-fetoglobulin, FETA, HPAFP) discontinued

Sign In for Pricing
View Details