Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Sensitive to high expression protein 9, mitochondrial (SHE9)

This Recombinant Saccharomyces cerevisiae Sensitive to high expression protein 9, mitochondrial (SHE9) spans the amino acid sequence from region 31-456.

Product Specifications

Product Name Alternative

Sensitive to high expression protein 9, mitochondrial, Mitochondrial distribution and morphology protein 33

UniProt

A6ZYZ4

Expression Region

31-456

Origin

Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FHYSSYSLQNDDTPDKGSTNKSEIRTPNNTVWKENIELQWQHLKKKLNELYSRFNFHRDQ LSFQVNKAKKSIQEANRKLSEQENEINDSRLNYNKDELTSAKIEGLPSEREQHRKKWSRK LEFYFDSLQETLFTATRALNDVTGYSGIQKLKSSISLMEKKLEATKKEHKLFKAQYANAI DERAQSQREVNELLQRQSAWSSSDLERFTQLYKNDALNARQEQELKNKVKEIESKEEQLN DDLYRAILTRYHEEQIWSDKIRRTSTWGTFILMGMNIFLFIVLQLLLEPWKRKRLVGSFE DKVKSALNEYAKEQNMKMDKLLPGKSSEVTDQGNTKNSIVEEHIEQRGECKINTAETDRP EVATAEATTTAMKSFRDIWERIKALFVTLKSIQYRKLDAPLVFDTLEFYLYSISLVSMTI LVSGLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
BNC880630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-100 1x 100 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL
BNC940994-100 1x 100 µL

TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details