Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsB (ccsB)

This Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsB (ccsB) spans the amino acid sequence from region 1-426.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsB

UniProt

Q3AZN7

Expression Region

1-426

Origin

Synechococcus sp. (strain CC9902)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRLIAWLSDLRVAIVLLFLIALASAVGTAIPQGDAPRSYVEAYATRPWLGLLNGEQVLQ LQLDHVYSSVWFLSLLAWLGLALILCSWRRQWPALQAARRWIDYSNPRQLSKLAIAESLP CTDSNSALQAFSTVLSQQGWRLERKDNRLAARKGTAGRVGPLLVHTGLILLMLGAVWGVL AGNRLERFLAPGRTLDLLSRDGDSQVSILLEAFQVDRDPAGRAEQFRSQLHLEENGNSLD REISVNHPLRHRGITIYQADWSLAAITLQIGRSPQLQLALRSFPELGEQVWGLVLPTRPD GSEPVFLSVENEQGPINIFDTDGTLLTLLRPGGPAVDVKGLPMRVNSVLPASGLLLKRDP GVPLVYLGFAVMLIGGGLSLIATRQLWAIASEGQLHVGGLCNRNLTAFSKELPSLLRQTA LAHQQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details