Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yjiN (yjiN)

This Recombinant Escherichia coli Uncharacterized protein yjiN (yjiN) spans the amino acid sequence from region 1-426.

Product Specifications

Product Name Alternative

Uncharacterized protein yjiN

UniProt

P39385

Expression Region

1-426

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKLIELRRAKRLALSLLLIAAATFVVTLFLPPNFWVSGVKAIAEAAMVGALADWFAVVA LFRRVPIPIISRHTAIIPRNKDRIGENLGQFVQEKFLDTQSLVALIRRHEPALLIGNWFS QPENARRVGQHLLQIMSGFLELTDDARIQRLLKRAVHRAIDKVDLSGTSALMLESMTKND RHQVLLDTLIAQLIALLQRDKSRKFIAQQIVRWLESEHPLKAKILPTEWLGEHSAELVSD AVNSLLDDISRDRAHQIRHAFDRATFALIDKLKNDPEMAARADAVKSYLKEDEAFNRYLS ELWGDLREWLKVDINSEDSRVKERIARAGQWFGETLIADDALRASLNGHLEQAAHRVAPE FSAFLTRHISDTVKSWDARDMSRQIELNIGKDLQFIRVNGTLVGGCIGLILYLLSQLPAL FPLGNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (DO-7), CF405S conjugate, 0.1mg/mL
BNC040513-500 1x 500 µL

P53 (DO-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF405S conjugate, 0.1mg/mL
BNC040914-500 1x 500 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF568 conjugate, 0.1mg/mL
BNC681880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details