Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Inward rectifier potassium channel 2 (KCNJ2)

This Recombinant Rabbit Inward rectifier potassium channel 2 (KCNJ2) spans the amino acid sequence from region 1-427.

Product Specifications

Product Name Alternative

Inward rectifier potassium channel 2, Inward rectifier K (+) channel Kir2.1, IRK-1, Potassium channel, inwardly rectifying subfamily J member 2

UniProt

P49656

Expression Region

1-427

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASRESK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDMDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP LRRESEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GALNT2 (NM_152490) Human Recombinant Protein
TP306913M 100 µg

B3GALNT2 (NM_152490) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human HSPB8 Protein (His Tag)
PKSH032525-01 10 µg

Recombinant Human HSPB8 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HSPB8 Protein (His Tag)
PKSH032525-02 50 µg

Recombinant Human HSPB8 Protein (His Tag)

Sign In for Pricing
View Details
1’-Hydroxy N-Trityl Medetomidine
TRC-H974400-100MG 100 mg

1’-Hydroxy N-Trityl Medetomidine

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS802895 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: right middle lobe
CS648056 5x 5 µm

Frozen Tissue Sections, Lung: right middle lobe

Sign In for Pricing
View Details