Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Inward rectifier potassium channel 2 (KCNJ2)

This Recombinant Rabbit Inward rectifier potassium channel 2 (KCNJ2) spans the amino acid sequence from region 1-427.

Product Specifications

Product Name Alternative

Inward rectifier potassium channel 2, Inward rectifier K (+) channel Kir2.1, IRK-1, Potassium channel, inwardly rectifying subfamily J member 2

UniProt

P49656

Expression Region

1-427

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASRESK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDMDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP LRRESEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP11B1 (NM_001026213) Human Over-expression Lysate
LC422463 20 µg

CYP11B1 (NM_001026213) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant CD13 Antibody
RC-7066-01 50 μL

Recombinant CD13 Antibody

Sign In for Pricing
View Details
Recombinant CD13 Antibody
RC-7066-02 100 µL

Recombinant CD13 Antibody

Sign In for Pricing
View Details
Recombinant CD13 Antibody
RC-7066-03 1 mL

Recombinant CD13 Antibody

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), Biotin conjugate, 0.1mg/mL
BNCB2409-100 1x 100 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZDHHC11 (NM_024786) Human Recombinant Protein
TP304383M 100 µg

ZDHHC11 (NM_024786) Human Recombinant Protein

Sign In for Pricing
View Details