Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Inward rectifier potassium channel 2 (KCNJ2)

This Recombinant Pig Inward rectifier potassium channel 2 (KCNJ2) spans the amino acid sequence from region 1-427.

Product Specifications

Product Name Alternative

Inward rectifier potassium channel 2, Inward rectifier K (+) channel Kir2.1, IRK-1, Potassium channel, inwardly rectifying subfamily J member 2

UniProt

O18839

Expression Region

1-427

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSVRTNRYSIVSSEEDGMKLATLAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKESK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP LRRESEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-100 1x 100 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-500 1x 500 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-100 1x 100 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF640R conjugate, 0.1mg/mL
BNC402096-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF488A conjugate, 0.1mg/mL
BNC882598-500 1x 500 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details