Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsB (ccsB)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsB (ccsB) spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsB

UniProt

A2BYI5

Expression Region

1-428

Origin

Prochlorococcus marinus (strain MIT 9515)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIFKNLILKISSLKFAITLIIFIAITSGVGTFIPQGNDPQEYIDFYNETPIFGLINGYQ VIKLQLNHVYTSNWFLFSLILLCISLAACSFRRQIPSLKAALKWTDYKNEKRFYKLQLTT NYKVSQDVNHILKADSLLRKKGWSISKFENRLSARKGLVGKLGPIIVHIGLIILLIGSAY GNFSSQSKEQYLRLGESLDLINENKNSKFTIKLNNFLIERESDGKPKQFISYLNFFSEEQ HLNEIKTTQVNHPIRFRGLTIYQADWSVSNIVLEIDSVLYQLKLKPIPEIGDQIWGLLIE LGRENKKNYLLTIDNENGPLKVSNIKDFSEMFIYLNDDPIEINSSKLSLKKIIPSSGLII KNDPSIPFIYLAFTLIILGTIFSLIPTNQIWILFNENSNKLFVGGLSNRNLLGFKKEFQK LSDEIKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vaccinia Virus B18R / B19R Protein (His Tag)
PKSV030257 100 µg

Recombinant Vaccinia Virus B18R / B19R Protein (His Tag)

Sign In for Pricing
View Details
Galectin 1 (LGALS1) Mouse Monoclonal Antibody [Clone ID: 24CT661.4.4]
AM11026SU-N 100 µL

Galectin 1 (LGALS1) Mouse Monoclonal Antibody [Clone ID: 24CT661.4.4]

Sign In for Pricing
View Details
NAB1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F1]
TA802911BM 100 µL

NAB1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F1]

Sign In for Pricing
View Details
TRIM68 (NM_018073) Human Over-expression Lysate
LC402645 20 µg

TRIM68 (NM_018073) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS705174 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Recombinant UFD1 Antibody
RC-5463-01 50 μL

Recombinant UFD1 Antibody

Sign In for Pricing
View Details