Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsB (ccsB)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsB (ccsB) spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsB

UniProt

A3PEU8

Expression Region

1-428

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIVKDLIFRISSLKFAISLIIFIAISSGVGTFIPQGSNSKFYIENFDEAPIFGFLNGEK VLILQLDHIYTSLWFLFALILLCISLAACSFRRQIPSLKASLKWIEYKSEKKFRKLQLNS SYQINEVEDLISKADLFLKKRGWKTYKFKSHISARKGLIGKIGPLVVHIGLIVLLIGSAY GSFTSQSKEQYLLPGESLDLINESTNSKANIKLVDFSIERESDGIPKQFISKLDFTSEDS KFNEVKTAKVNHPIRFKGLTIYQADWAISNIVLEIDNILYQLQLKEIPEIGNQVWGILIE LGSETKKNFLLTIDNENGPLKISNTENFSGNNLYINENPLEVNSSKVSLKKIIPSSGLII KNDPSIPFIYFSFILIIFGTIISLIPTNQLWILVNQESQSLSIGGLSNKNLVGFKKEFFK LSEEIKNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA0999 Peptide - middle region (AAP53784)
AAP53784-100UG 100 µg

KIAA0999 Peptide - middle region (AAP53784)

Sign In for Pricing
View Details
Mouse Aimp1 (NM_007926) AAV Particle
MR204393A1V 250 µL

Mouse Aimp1 (NM_007926) AAV Particle

Sign In for Pricing
View Details
Tmem56 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4482208 1.0 µg DNA

Tmem56 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Perfluoroheptanoic acid
sc-236337 5 g

Perfluoroheptanoic acid

Sign In for Pricing
View Details
HSF4, NT (HSF4, Heat shock factor protein 4, Heat shock transcription factor 4) (MaxLight 550) discontinued
036791-ML550 100 µL

HSF4, NT (HSF4, Heat shock factor protein 4, Heat shock transcription factor 4) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Botulinum neurotoxin type A (1280-1292) mouse monoclonal antibody, clone B364M, Azide Free
AM31421AF-N 1 mL

Botulinum neurotoxin type A (1280-1292) mouse monoclonal antibody, clone B364M, Azide Free

Sign In for Pricing
View Details