Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsB (ccsB)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsB (ccsB) spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsB

UniProt

A3PEU8

Expression Region

1-428

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIVKDLIFRISSLKFAISLIIFIAISSGVGTFIPQGSNSKFYIENFDEAPIFGFLNGEK VLILQLDHIYTSLWFLFALILLCISLAACSFRRQIPSLKASLKWIEYKSEKKFRKLQLNS SYQINEVEDLISKADLFLKKRGWKTYKFKSHISARKGLIGKIGPLVVHIGLIVLLIGSAY GSFTSQSKEQYLLPGESLDLINESTNSKANIKLVDFSIERESDGIPKQFISKLDFTSEDS KFNEVKTAKVNHPIRFKGLTIYQADWAISNIVLEIDNILYQLQLKEIPEIGNQVWGILIE LGSETKKNFLLTIDNENGPLKISNTENFSGNNLYINENPLEVNSSKVSLKKIIPSSGLII KNDPSIPFIYFSFILIIFGTIISLIPTNQLWILVNQESQSLSIGGLSNKNLVGFKKEFFK LSEEIKNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2-Oa ORF Vector (Mouse) (pORF)
22928014 1.0 µg DNA

H2-Oa ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Complement Component 4a (C4a) ELISA Kit
MBS453993-01 48 Tests

Mouse Complement Component 4a (C4a) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Component 4a (C4a) ELISA Kit
MBS453993-02 96 Tests

Mouse Complement Component 4a (C4a) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Component 4a (C4a) ELISA Kit
MBS453993-03 5x 96 Tests

Mouse Complement Component 4a (C4a) ELISA Kit

Sign In for Pricing
View Details
Mouse Complement Component 4a (C4a) ELISA Kit
MBS453993-04 10x 96 Tests

Mouse Complement Component 4a (C4a) ELISA Kit

Sign In for Pricing
View Details
Arrdc4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6232008 1.0 µg DNA

Arrdc4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details