Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Cell number regulator 13 (CNR13)

This Recombinant Zea mays Cell number regulator 13 (CNR13) spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Cell number regulator 13, ZmCNR13

UniProt

B6SJQ0

Expression Region

1-428

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASWDNLGELSNIAQLTGLDAVKLISLIVRAASTARLHKRNCRRFAQHLKLIGGLLEQLR VSELRKYPETREPLEQLEDALRRGYLLVNSCQDRSYLYLLAMGWNIVYQFRKAQSEIDNY LRLVPLITLVDNARIRDRLEYIERDQCEYSFDEEDKKVQDALLNPDPCTNPTIVLKKTLS CSYPNLPFNEALRKESEKLQVELQRSQSNMDLGSCEVIQHLLGVTKTVESTIPEKETNVK APEKKGSNYSESKGETAKSFDDDDDYPKKQNGDYPKKQKDTCSTQRCSSQVPYGHDLVSS RGSYSDEWHADLLGCCSKPALCLKTLFFPCGTFSRIASIAKDRPMSSGEACNDIMAYSLI LSCCCYTCCVRRKLRQKLDIAGGCCDDFLSHLLCCCCALVQEWREVEIRGAYSEKTKVTP PACQYMEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-100 1x 100 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF640R conjugate, 0.1mg/mL
BNC402452-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (2H11 + 6E1), CF405S conjugate, 0.1mg/mL
BNC040724-500 1x 500 µL

Thyroglobulin (2H11 + 6E1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF640R conjugate, 0.1mg/mL
BNC402616-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details