Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome c biogenesis protein CcsB (ccsB)

This Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome c biogenesis protein CcsB (ccsB) spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsB

UniProt

Q7V028

Expression Region

1-428

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVIFKKFILKISSLRFAILLIIFIAISSGVGTFIPQGNDQQEYIDFYNETPILGFINGSQ VIRLQLDHIYTSNWFLFSLILLCISLAACSFRRQIPSLKAALKWTDYKDEKKFYKLELIT NYEIIQDADHILKADSLLRKKGWNISKFENRLSARKGLEGKLGPIIVHIGLIILLIGSAY GNFSSQSKEQYLRLGESLDLINESTNSRVKIKLKNFFIERESDGKPKQFISNLEFFSKQQ NLNEIKTTQVNQPIRFKGLTIYQADWSVSNIVMEIDSVLYQLQLKPIPEIGDQIWGLLIE LGRENKKNYLLTIDNENGPLKVSNIEDFSENFVYLNNNPIEINSSKLSLKKIIPSSGLII KNDPSIPFIYLSFTLIIVGTILSLIPTNQIWILFNENTNKLFIGGLSNRNLLGFKKEFLK LSDEIKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kif16b (NM_001107783) Rat Tagged ORF Clone
RR209080 10 µg

Kif16b (NM_001107783) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mmu-miR-3093-5p miRNA Inhibitor
CIM0771-01 10 nmol

Mmu-miR-3093-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-3093-5p miRNA Inhibitor
CIM0771-02 20 nmol

Mmu-miR-3093-5p miRNA Inhibitor

Sign In for Pricing
View Details
Solanum tuberosum Lectin (STA/STL) - Separopore® 4B
20120067-2 5 mL

Solanum tuberosum Lectin (STA/STL) - Separopore® 4B

Sign In for Pricing
View Details
NDUFB10 Human qPCR Template Standard (BC007509)
HK200283 1 Kit

NDUFB10 Human qPCR Template Standard (BC007509)

Sign In for Pricing
View Details
C6orf130 (OARD1) (NM_145063) Human Tagged Lenti ORF Clone
RC203998L4 10 µg

C6orf130 (OARD1) (NM_145063) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details