Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized protein C23A1.02c (SPAC23A1.02c)

This Recombinant Schizosaccharomyces pombe Uncharacterized protein C23A1.02c (SPAC23A1.02c) spans the amino acid sequence from region 1-430.

Product Specifications

Product Name Alternative

Uncharacterized protein C23A1.02c

UniProt

O42841

Expression Region

1-430

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFARHPNLLWLNKQLSILHYLCLVFLAVYYAYPLLFGIMPRKLQLEDENSFVIMGVADPQ IEGNHKIEANGFFKGTLDLWGNDLFLRHLVHMNQFWGQPDAMILLGDLVSFQHLDNEEFN KRAKRLKKITGAKNFWQVGNSSLPARTFENGNIPVWTIAGNHDIGYGCESSDAQISKWEQ AMGPVNWVSHFNVSKFPVRVIGINSLSLDDVQFYDANPSDIINSKSFSSLGILALSKEAR DAWQFLFDIALEPSIPTILFTHVPLYKPANVCVDEPRIVRQLDFRVKSQNHLSYNTTMKI FELIPSIKLVLSGHDHMGCDYEHPNGAIEHTLPSAMGYFGGNIGFVKLIATNDVLTESSK NTPSVVTFLIQKLIGQRWKKASLKQSKFSSDIYATYTLSHGGPSYIWWALHISVCVLTIL RLLVISLQHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-500 1x 500 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IDH1 (IDH1/1152), CF405S conjugate, 0.1mg/mL
BNC041152-100 1x 100 µL

IDH1 (IDH1/1152), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF594 conjugate, 0.1mg/mL
BNC941917-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), Biotin conjugate, 0.1mg/mL
BNCB1429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details