Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsB (ccsB)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsB (ccsB) spans the amino acid sequence from region 1-430.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsB

UniProt

Q7V5R7

Expression Region

1-430

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATFKRLLAWISDLRIAIGLLLVIALASALGTAIPQGELRESYLEGYSDKPWLGFVNGSM ILRLQLDHVYTSSWFLALLAWLGLALILCSWRRQWPALQAALQWIDYQEPRQLSKLAIAE TISSPPKNESIDKLAAHLHQQGWQVQQQPGRLAARRGIIGRAGPMLVHLGLVLLMLGAVW GSLGGNRLEQFLAPGRSLDLLNRDGNSHLKLTLTNFGIERDPAGRPEQFRSQLELLEPGQ DTAKLHEVSVNHPLRFHGLTVYQADWSLAAITLQLGRSPQLQLPLRTFPELGEQVWGLVL PTNPDGSEPVLLSLTSEAGPVQVFDATGERLASLRPAGPTAEVKGIPIRIVDVLPASGLL LKRDPGVPLVYIGFLITLVGGGLSMIATRQLWAVGDPENECLHVGGLCNRNLTGFANELP SLLAAAVPQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-500 1x 500 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/836), CF568 conjugate, 0.1mg/mL
BNC680836-100 1x 100 µL

Cytokeratin 18 (KRT18/836), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (SOX10/2311R), CF568 conjugate, 0.1mg/mL
BNC682311-500 1x 500 µL

SOX10 (Melanoma Marker) (SOX10/2311R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details