Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse V-type proton ATPase subunit S1 (Atp6ap1)

This Recombinant Mouse V-type proton ATPase subunit S1 (Atp6ap1) spans the amino acid sequence from region 33-463.

Product Specifications

Product Name Alternative

V-type proton ATPase subunit S1, V-ATPase subunit S1, Protein C7-1, V-ATPase Ac45 subunit, V-ATPase S1 accessory protein, Vacuolar proton pump subunit S1

UniProt

Q9R1Q9

Expression Region

33-463

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VATEQQVPLVLWSSDRNLWAPVADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLS IEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLH VDLATLKELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLKSEDVPYT AALTAVRPSRVARDITMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPRILFWAQNFSVAY KDEWKDLTSLTFGVENLNLTGSFWNDSFAMLSLTYEPLFGATVTFKFILASRFYPVSARY WFAMERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSVSKKGNLLVTNVPSVWQMTLHN FQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDH KGPTITLTQIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dpm2 AAV siRNA Pooled Vector
18539166 1.0 µg

Dpm2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Goat HB (Hemoglobin) ELISA Kit
EK251501 96 Well

Goat HB (Hemoglobin) ELISA Kit

Sign In for Pricing
View Details
Zinc Sulphate Heptahydrate Purified (Zinc sulphate-7-hydrate) 99.0%
030621-01 25 Kg

Zinc Sulphate Heptahydrate Purified (Zinc sulphate-7-hydrate) 99.0%

Sign In for Pricing
View Details
Zinc Sulphate Heptahydrate Purified (Zinc sulphate-7-hydrate) 99.0%
030621-02 500 g

Zinc Sulphate Heptahydrate Purified (Zinc sulphate-7-hydrate) 99.0%

Sign In for Pricing
View Details
Zinc Sulphate Heptahydrate Purified (Zinc sulphate-7-hydrate) 99.0%
030621-03 1 kg

Zinc Sulphate Heptahydrate Purified (Zinc sulphate-7-hydrate) 99.0%

Sign In for Pricing
View Details
Zinc Sulphate Heptahydrate Purified (Zinc sulphate-7-hydrate) 99.0%
030621-04 5 Kg

Zinc Sulphate Heptahydrate Purified (Zinc sulphate-7-hydrate) 99.0%

Sign In for Pricing
View Details