Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse V-type proton ATPase subunit S1 (Atp6ap1)

This Recombinant Mouse V-type proton ATPase subunit S1 (Atp6ap1) spans the amino acid sequence from region 33-463.

Product Specifications

Product Name Alternative

V-type proton ATPase subunit S1, V-ATPase subunit S1, Protein C7-1, V-ATPase Ac45 subunit, V-ATPase S1 accessory protein, Vacuolar proton pump subunit S1

UniProt

Q9R1Q9

Expression Region

33-463

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VATEQQVPLVLWSSDRNLWAPVADTHEGHITSDMQLSTYLDPALELGPRNVLLFLQDKLS IEDFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAISTLTTYLQEKLGASPLH VDLATLKELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLKSEDVPYT AALTAVRPSRVARDITMVAGGLGRQLLQTQVASPAIHPPVSYNDTAPRILFWAQNFSVAY KDEWKDLTSLTFGVENLNLTGSFWNDSFAMLSLTYEPLFGATVTFKFILASRFYPVSARY WFAMERLEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSVSKKGNLLVTNVPSVWQMTLHN FQIQAFNVTGEQFSYASDCAGFFSPGIWMGLLTTLFMLFIFTYGLHMILSLKTMDRFDDH KGPTITLTQIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1561490 Protein Lysate (Rat) with C-HA Tag
39249036 100 µg

RGD1561490 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Hemoglobin antibody
10C-CR8000M2 1 mg

Hemoglobin antibody

Sign In for Pricing
View Details
Lentiviral mouse Jak2 shRNA (UAS) - Lentiviral mouse Jak2 shRNA (UAS, iRFP) (25)
GTR15191858 1 Vial

Lentiviral mouse Jak2 shRNA (UAS) - Lentiviral mouse Jak2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lentiviral mouse Ppif shRNA (UAS) - Lentiviral mouse Ppif shRNA (UAS) (25)
GTR15210845 1 Vial

Lentiviral mouse Ppif shRNA (UAS) - Lentiviral mouse Ppif shRNA (UAS) (25)

Sign In for Pricing
View Details
ARHGEF7 Antibody (Biotin)
orb240341-01 50 µg

ARHGEF7 Antibody (Biotin)

Sign In for Pricing
View Details
ARHGEF7 Antibody (Biotin)
orb240341-02 100 µg

ARHGEF7 Antibody (Biotin)

Sign In for Pricing
View Details