Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0053 protein yrkA (yrkA)

This Recombinant Bacillus subtilis UPF0053 protein yrkA (yrkA) spans the amino acid sequence from region 1-434.

Product Specifications

Product Name Alternative

UPF0053 protein yrkA

UniProt

P54428

Expression Region

1-434

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTINLIIFTLLIVLTAFFVATEFAIVKIRSSKIDQLILEGKKGAISAKKVITHLDEYLS ACQLGITVTALGIGWVGESTFEVILHPLFAHFHVSETVSHVLILVIAFVMATFLHVVVGE LAPKTLAIQKAETITLLTAKPIIWFYRILFPFIWFLNGSARFIVGLFGLKPASEHELAHS EEELRILLSESYKSGEINQNELKYVNNIFEFDERIAKEIMIPRREIVAISSEDSYETIVK IIKTESYTRYPVLNGDKDSIIGFINAKEFLSAYIDTDQKIKEDFKLENHINPVIHVIESV PIHDVLVKMQKERTHIAILVDEYGGTSGLVTAEDILEEIVGEIRDEFDKDEVPNIRKVND NHYILDSKVLIEDVNDLLGTTLASDEVDTIGGWFMTQQIDAAVGSVIEADGYIFKVHETV GRHINYLEIVRKKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-100 1x 100 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rTP53/1739), CF740 conjugate, 0.1mg/mL
BNC742091-500 1x 500 µL

P53 Tumor Suppressor Protein (rTP53/1739), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF405S conjugate, 0.1mg/mL
BNC040743-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF660R conjugate, 0.1mg/mL
BNC610172-100 1x 100 µL

CD45 / LCA (135-4C5), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details