Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Putative magnesium transporter MRS2-D (MRS2-D)

This Recombinant Oryza sativa subsp. japonica Putative magnesium transporter MRS2-D (MRS2-D) spans the amino acid sequence from region 1-434.

Product Specifications

Product Name Alternative

Putative magnesium transporter MRS2-D

UniProt

Q7XQQ1

Expression Region

1-434

Origin

Oryza sativa subsp. japonica (Rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAARRRHVAAGAGAPAPAAGEWAAVTAGGGAAWALSPVEEVGTKQELMRRTGLPPRDLRA LDPALSSAASASSCRPSAITGRDRAVVVNLDRARAVITASEVLVPSPRDPAVAPLVRELR ARLALAASPTPAPSPSPPQHGMAVGMDGSISPSQASRGGEEAAGNGKDGEALGGGDKALP FEFRALEVCLEFACKSLEHETCTLEKEAYPALDELTSKVSTLNLERVRQIKSRLVAISGK VQKVRDELEHLLDDDMDMAALHLTEKLAYQSSRFDIDKEASELEDHSSRDEEGVEGGGGG DGDDETIAGGGSFSPNTDELEILLESYFVQIDGTLNSLSTLREYVEDTEDYINMMLDEKQ NQLLQMGILLSTGTLVSSCAIAVTGVFGINVHISLYDSPASSAAFPCAAAGIVAGSLALY LAALLCYKRAGILQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-100 1x 100 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF740 conjugate, 0.1mg/mL
BNC740264-100 1x 100 µL

Human Kappa Light Chain (KLC264), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 (DOG1.1), CF647 conjugate, 0.1mg/mL
BNC470725-500 1x 500 µL

DOG-1 (DOG1.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details