Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c biogenesis protein ccsB (ccsB)

This Recombinant Cytochrome c biogenesis protein ccsB (ccsB) spans the amino acid sequence from region 1-435.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein ccsB

UniProt

B1X3X2

Expression Region

1-435

Origin

Paulinella chromatophora

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHVLKWISDLRVAIFLLLIIALSSSLGTALPQKESAESYYEAYNSSPWLKVFSGESIIQ LQLDHVYSSDWFLSLLLWLGIALVFCSWRRQLPALQFTLRWIDYCNPRQLSKLALAETII STDASASIKRLEQLLKNQGWQVQAKSGRLAARRGIAGRVGPLMVHTGLVILMLGAVWGVL GGHRLERFLAPGREMELLNSHGKSQLNIALESFQIERDPVGRPEQYRSQLRLRELGNSRE NNSGSIDKSLNREISVNHPLRYGGMTVYQADWALAAITVQLGRSPLLQLPLEQFPQLGEQ VWGVVLPTQQDGSNPVLLALSSEKGPIEVFASDGSLITTLRPGGVAATINDVKVRVESIL PASGLLLKRDPGVPLVYIGFAVALMGGGLSLISTRQIWAIAELEQQRFHVGGLCNREFTN FAQELPQFISEIQQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
BNC740676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2), CF647 conjugate, 0.1mg/mL
BNC470631-100 1x 100 µL

Human Lambda Light Chain (LcN-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details