Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Mitochondrial inner membrane magnesium transporter mrs2 (MRS2)

This Recombinant Candida albicans Mitochondrial inner membrane magnesium transporter mrs2 (MRS2) spans the amino acid sequence from region 34-468.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane magnesium transporter mrs2, RNA-splicing protein MRS2

UniProt

Q5A970

Expression Region

34-468

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KSNNVGSQDSKRTSKNSILHNLGSYSNSAESEILNKLKPITPNDLYVSCTSFDRIGNITA VSRKYPKMQFLKENHLFPRDLRKIDTSSIDVVPVIMIRPSSAILVNLLHIKAIIKKDNVM VFDTSKSEVATKLGIFMYDLELKLKSPANNVCYEFRALESILVSVTSYLEAEIKLHRQQC GIILAELEDEVDRAKLQELLIRSKKLSSFHQRAILIRDVLEELLENDEDLAGMYLTDLKR FEPEEENYEEIESILESYYNQCDEYVQQAGSLLSDIKATEEIVNIILDANRNSLMLFELK ITVYTLGFTVATLVPAFYGMNLKNYIEETNWGFGLVLVVSLLQGLAITWLNFRKLHKVQK LTMMGTSNSSKAGTGLSRHIPPTSRVDRWKRGSFLYRLFYGSGGKYSKPSKKFDRPTNRE KDAMWRMINDDKAMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
BNC880669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-500 1x 500 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-100 1x 100 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T-Cell Leukemia Marker) (CD7/3737), CF740 conjugate, 0.1mg/mL
BNC742056-500 1x 500 µL

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details