Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopA (yopA)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yopA (yopA) spans the amino acid sequence from region 1-438.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yopA

UniProt

O31937

Expression Region

1-438

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENIALESSFLEYDINEPIKIYTGHFTIEVADDFFEILGEVKIAFLPKARLIFEGAISGN LSKLFEFEKAMKSNNMMINVPGFMKSEVLISGITDGSKGNKVSGILKRSILTSAETKVNR MEFTVVNFVNDLGRRIVHGRFKFSGRTKLKYKDWEIILDKRYDYSNKKIFDRLKNSGGYL ITHVGYLKRVDDKLFDTKEVEPLISGLYWLLSFSAGRHVAIPTLEGYHNEEVIWSKYQVP LIDGWTNNITWFPKQKSPSLEHLFPKVIEKQEDPFWNKVLWEVLSWYSQAHSSSIVENKV VSVQVALETLAWVYLIVDRKSNISKSKYKYMNAAEKFREILSRFSIDLSIPKLFIDIKDN YDDGPHLFTVFRNKIVHPTRELDFDNPIDKLHVLYLGVWYLELLTLGILGYEGSYVNRLK VPIIEGVYEFVPWKTRDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Oligodendrocyte Lineage Transcription Factor 2 (OLIG2) ELISA Kit
MBS2704620-01 24 Strip Well

Human Oligodendrocyte Lineage Transcription Factor 2 (OLIG2) ELISA Kit

Sign In for Pricing
View Details
Human Oligodendrocyte Lineage Transcription Factor 2 (OLIG2) ELISA Kit
MBS2704620-02 48 Well

Human Oligodendrocyte Lineage Transcription Factor 2 (OLIG2) ELISA Kit

Sign In for Pricing
View Details
Human Oligodendrocyte Lineage Transcription Factor 2 (OLIG2) ELISA Kit
MBS2704620-03 96 Well

Human Oligodendrocyte Lineage Transcription Factor 2 (OLIG2) ELISA Kit

Sign In for Pricing
View Details
Human Oligodendrocyte Lineage Transcription Factor 2 (OLIG2) ELISA Kit
MBS2704620-04 5x 96 Well

Human Oligodendrocyte Lineage Transcription Factor 2 (OLIG2) ELISA Kit

Sign In for Pricing
View Details
Human Oligodendrocyte Lineage Transcription Factor 2 (OLIG2) ELISA Kit
MBS2704620-05 10x 96 Well

Human Oligodendrocyte Lineage Transcription Factor 2 (OLIG2) ELISA Kit

Sign In for Pricing
View Details
RDH10 Protein Vector (Mouse) (pPB-C-His)
PV223262 500 ng

RDH10 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details