Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Nuclear rim protein 1 (NUR1)

This Recombinant Candida glabrata Nuclear rim protein 1 (NUR1) spans the amino acid sequence from region 1-438.

Product Specifications

Product Name Alternative

Nuclear rim protein 1

UniProt

Q6FL09

Expression Region

1-438

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSWLIPDIPELFLTISVWFRLQGWEDNTKLGFIIGNTLTTIFYILRLAQDTLLAGVSRK LIRDYELFDLSKSETLLSDPAFSSYHDVLFNKHHSTANASSYNKRVRKVTSTVYWSTYFL LLLSCYTCYRLFNTYKVYRIYYLKDLNLDKHPSLKKIEPDYEVDEKLLKTSLKSKLLSRF IRLLQLQDEVETELPKVTEHYTLNKWDPSKLIISLSTSFSPTIIICLMYTNVTFLTVIPI IIHQGIFYFMIWNRYEERFKDDALLMRENYLQYDTKYVKPLKQIMYQDVMTDTATISDGG FTKFFPVSKSTLFKHHEMSGDVIIERYNKKSREFENVTDIIKPHHHINNTVKILPPTIRK DHKTNRYDHRQQSILKDRKFNIDSNEPQIINALTTAIPSRSFFNNNPSGSNDDNCSGIKV RSSPTRETFFPATPLRKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-500 1x 500 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Transglutaminase II (TGM2/419), CF640R conjugate, 0.1mg/mL
BNC400419-100 1x 100 µL

Transglutaminase II (TGM2/419), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin A2 (E67), CF568 conjugate, 0.1mg/mL
BNC680673-500 1x 500 µL

Cyclin A2 (E67), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (IGA/1790R), CF647 conjugate, 0.1mg/mL
BNC471790-500 1x 500 µL

CD79a (B-Cell Marker) (IGA/1790R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL
BNC400461-500 1x 500 µL

Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (Kap-56), CF640R conjugate, 0.1mg/mL
BNC400859-500 1x 500 µL

Human Kappa Light Chain (Kap-56), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details