Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c biogenesis protein ccs1 (ccs1)

This Recombinant Cytochrome c biogenesis protein ccs1 (ccs1) spans the amino acid sequence from region 1-440.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein ccs1

UniProt

Q4G3C0

Expression Region

1-440

Origin

Emiliania huxleyi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVFSTKLYTTKLLKKLADLRLAIWLLASIGILIALGTFIEQDQPLAFYQENYPTTAPILG FVDWKFITSLNLNTLYSNIWFFGIVGFFASSLLACTYTTQIPALKKFRLWEFITNFKSLR KFQLKRQLPRNLASTSVYQLYGKNYHVFRQGKKNYAYSGLLGRVGPILVHFSILFVLFGS ACGALGGYTVQEIVPRGEIFHLQNLVKSGNLSKIPQYLSWRVNDFWITYTEEAKVNQFYS DLSILDVKGQEVKRKIIFVNEPLVYNGVSVYQTDWDILGLKLKLNDQQTIQVPLNKISKS GRNFWLGSVFLDGNSKQKITILLNDLTGNIYVYDNAGLLVATTKLGQLVVFPEDQSLRFQ EFLTTTGLQLKEDPGLRLIYLSFFLVMVSIYISFLSYSQIWGFEKTDEFILAGKSNRAVL AFQEDFKKDVKEILNTLKFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-500 1x 500 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-100 1x 100 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF405S conjugate, 0.1mg/mL
BNC042265-500 1x 500 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details